Skip to main content

Table 2 Identified Plasma Membrane Protein Spots in 24 h ZEA-treated HL-60 Cells by LC/MS/MS.

From: Mitochondrial and endoplasmic reticulum stress pathways cooperate in zearalenone-induced apoptosis of human leukemic cells

Spot no. Protein Name(s) Description MW/pI Peptide match % Coverage Sequence *Expression in treated cells (folds)
1 TERA_HUMAN Transitional endoplasmic reticulum ATPase 89.3/5.18 - - - -1.99
2 GFAP_HUMAN Glial fibrillary acidic protein 49.8/5.25 1 2.55 (K)LALDIEIATYR(K) -1.55
  K2C8_HUMAN Keratin, type II cytoskeletal 8 53.7/5.34 1 2.28   
  HS90A_HUMAN Heat shock protein HSP 90-alpha 83.2/4.97 7 10.00 K.IDIIPNPQER.T
K.EDQTEYLEER.R
K.HFSVEGQLEFR.A
R.RAPFDLFENK.K
R.GVVDSEDLPLNISR.E
K.FYEAFSK.N
K.EGLELPEDEEEK.K
 
3 GRP78_HUMAN 78 kDa glucose-regulated protein precursor (GRP 78) 72.3/5.10 - - - 1.93
4 PLSL_HUMAN L-plastin, Lymphocyte cytosolic protein 1 70.2/5.02 11 22.01 (K)AACLPLPGYR(V)
(K)IGLFADIELSR(N)
(R)NEALIALLR(E)
(K)LSPEELLLR(W)
(K)AYYHLLEQVAPK(G)
(R)QFVTATDVVR(G)
(K)LNLAFIANLFNR(Y)
(R)VNHLYSDLSDALVIFQLYEK(I)
(K)FSLVGIGGQDLNEGNR(T)
(R)YTLNILEEIGGGQK(V)
(K)VNDDIIVNWVNETLR(E)
-3.1
5 CALR_HUMAN Calreticulin precursor 60.6/4.37 - - - 2.39
6 PDIA1_HUMAN Protein disulfide isomerase precursor 51.1/4.78 - - - 2.86
7 EF2_HUMAN Elongation factor 2 95.1/6.78 - - - -2.87
8 gi|28317 unnamed protein product 59.5/5.17 3 6.00 R.ALEESNYELEGK.I
R.QSVEADINGLR.R
R.NVQALEIELQSQLALK.Q
2.26
9 DHSA_HUMAN Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 72.6/7.04 4 8.43 (R)AAFGLSEAGFNTACVTK(L)
(R)GVIALCIEDGSIHR(I)
(K)NTVVATGGYGR(T)
(R)LGANSLLDLVVFGR(A)
-1.29
  TCPG_HUMAN T-complex protein 1 subunit gamma 60.5/6.06 1 2.02 (K)TAVETAVLLLR(I)  
10 SERA_HUMAN D-3-phosphoglycerate dehydrogenase 56.6/6.28 1 2.44 (K)GTIQVITQGTSLK(N) -1.34
  TCPZ_HUMAN T-complex protein 1 subunit zeta 58.0/6.22 1 2.26 (K)GIDPFSLDALSK(E)  
  gi|4502643 chaperonin containing TCP1, subunit 6A isoform a 58.0/6.23 7 15.00 R.AQAALAVNISAAR.G
K.QADLYISEGLHPR.I
R.IITEGFEAAK.E
K.ALQFLEEVK.V
K.SETDTSLIR.G
K.GIDPFSLDALSK.E
K.VLAQNSGFDLQETLVK.I
 
  gi|1002923 coronin-like protein 51.0/6.12 7 15.00 R.HVFGQPAK.A
R.EPVVTLEGHTK.R
R.AVFVSEGK.I
K.ILTTGFSR.M
R.DAGPLLISLK.D
R.AAPEASGTPSSDAVSR.L
K.LQATVQELQK.R
 
11 119623333 apoptosis inducing factor like isoform CRA d Homo sapiens 63.7/10.23 1 1.21 (R)LLSATSR(T) 2.18
  RN112_HUMAN RING finger protein 112 68.3/8.45 1 1.11 (R)LSGRYPK(V)  
  gi|4557014 catalase [Homo sapiens] 59.7/6.90 12 28.00 K.ADVLTTGAGNPVGDK.L
K.LNVITVGPR.G
K.GAGAFGYFEVTHDITK.Y
R.FR.DPILFPSFIHSQK.R
STVAGESGSADTVR.D
K.NLSVEDAAR.L
R.LSQEDPDYGIR.D
R.DLFNAIATGK.Y
R.LFAYPDTHR.H
K.DAQIFIQK.K
K.NFTEVHPDYGSHIQALLDK.Y
K.NAIHTFVQSGSHLAAR.E
 
  gi|28317 unnamed protein product 59.5/5.17 7 14.00 R.ALEESNYELEGK.I
K.YENEVALR.Q
R.QSVEADINGLR.R
K.ADLEMQIESLTEELAYLK.K
R.NVQALEIELQSQLALK.Q
K.QSLEASLAETEGR.Y
R.LENEIQTYR.S
 
12 SAM50_HUMAN Sorting and assembly machinery component 50 homolog 51.9/6.46 5 14.50 (K)VNQELAGYTGGDVSFIK(E)
(K)EDFELQLNK(Q)
(R)THFFLNAGNLCNLNYGEGPK(A)
(R)WSYGAGIVLR(L)
(R)ICDGVQFGAGIR(F)
-1.98
  gi|7022134 unnamed protein product 51.9/6.62 9 20.00 K.DVVVQHVHFDGLGR.T
K.VTFQFSYGTK.E
R.NFSVNLYK.V
K.VTGQFPWSSLR.E
K.WEGVWR.E
K.VNQELAGYTGGDVSFIK.E
K.EDFELQLNK.Q
R.FYLGGPTSVR.G
R.WSYGAGIVLR.L
 
  gi|4929571 CGI-51 protein 52.1/6.85 10 26.00 K.DVVVQHVHFDGLGR.T
K.VTFQFSYGTK.E
R.NFSVNLYK.V
K.VTGQFPWSSLR.E
K.WEGVWR.E
K.VNQELAGYTGGDVSFIK.E
K.EDFELQLNK.Q
K.QLIFDSVFSASFWGGMLVPIGDKPSSIADRFYLGGPTSIR.G
R.FYLGGPTSIR.G
R.WSYGAGIVLR.L
 
  ANX11_HUMAN Annexin A11 54.3/7.53 5 11.00 R.GTITDAPGFDPLR.D
K.TPVLFDIYEIK.E
R.LLISLSQGNR.D
R.SETDLLDIR.S
K.SLYHDISGDTSGDYR.K
 
13,14 ENOA_HUMAN Alpha-enolase 47.0/7.54 - - - -1.57,
-1.88
15 119571303 spectrin domain with coiled coils 1 isoform CRA d Homo sapiens 28.9/4.97 1 4.20 (R)LQIVSLASWAR(A) 5.14
  ATPG_HUMAN ATP synthase subunit gamma, mitochondrial 33.0/9.56 1 4.03 (R)IYGLGSLALYEK(A)  
  TPM3_HUMAN Tropomyosin alpha-3 chain 32.8/4.49 1 2.82 (K)HIAEEADR(K)  
  ES8L1_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 1 80.3/5.66 1 0.69 (K)SGPSR(K)  
  gi|16877071 ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1 32.9/9.23 3 11.00 R.IYGLGSLALYEK.A
K.HLLIGVSSDR.G
K.ELIEIISGAAALD.-
 
16 LDHB_HUMAN L-lactate dehydrogenase B chain 36.6/5.64 2 8.08 (K)SLADELALVDVLEDK(L)
(R)VIGSGCNLDSAR(F)
-1.62
  AFF4_HUMAN AF4/FMR2 family member 4 12.7/9.68 1 0.77 (K)NSSSTSKQK(K)  
17 COMT_HUMAN Catechol O-methyltransferase 30.0/5.12 2 14.02 (K)VTLVVGASQDIIPQLK(K)
(K)GTVLLADNVICPGAPDFLAHVR(G)
1.07
  PODXL_HUMAN Podocalyxin like protein 1 precursor 55.6/5.23 1 2.46 (R)LASVPGSQTVVVK(E)  
  121944562 immunoglobulin A heavy chain variable region Homo sapiens 11.9/5.64 1 5.50 (K)VDGIEK(Y)  
  TRM13_HUMAN tRNA guanosine-2'-O-methyltransferase TRM13 homolog 54.2/8.01 1 2.49 (R)KTSLETSNSTTK(R)  
18 ANXA1_HUMAN Annexin A1 38.7/6.63 5 22.00 K.GGPGSAVSPYPTFNPSSDVAALHK.A
K.GVDEATIIDILTK.R
K.ALTGHLEEVVLALLK.T
K.TPAQFDADELR.A
K.GTDVNVFNTILTTR.S
3.25
  CN102_HUMAN UPF0614 protein C14orf102 13.2/7.60 1 0.52 (R)LISLAK(C)  
19 SOCS4_HUMAN Suppressor of cytokine signaling 4 50.6/6.64 1 1.36 (R)SDLAFR(W) -3.12
  K2C1_HUMAN Keratin, type II cytoskeletal 1(CK-1) 65.8/8.16 4 5.00 R.QFSSR.S
K.AEAESLYQSK.Y
K.YEELQITAGR.H
K.LALDLEIATYR.T
 
  K2C7_HUMAN Keratin, type II cytoskeletal 7 (CK-7) 51.2/5.50 1 2.00 K.LALDIEIATYR.K  
20 gi|189054178 unnamed protein product [Homo sapiens] 66.0/7.62 4 6.00 R.SLDLDSIIAEVK.A
K.YEELQITAGR.H
K.LNDLEDALQQAK.E
R.TLLEGEESR.M
-2.84
21 AF047368_1 nebulette Homo sapiens 11.6/7.98 1 0.99 (K)ENQGNISSVK(Y) 2.99
  ERp29_HUMAN Endoplasmic reticulum protein ERp29 29.0/6.77 7 22.00 K.GALPLDTVTFYK.V
K.GALPLDTVTFYK.V
K.FVLVK.F
R.DGDFENPVPYTGAVK.V
K.QGQDNLSSVK.E
K.WAEQYLK.I
K.SLNILTAFQK.K
 
22 ATP5H_HUMAN ATP synthase subunit d, mitochondrial 18.5/5.21 6 40.00 K.TIDWVAFAEIIPQNQK.A
K.SWNETLTSR.L
R.LAALPENPPAIDWAYYK.A
K.AGLVDDFEK.K
K.YTAQVDAEEK.E
K.YTAQVDAEEKEDVK.S
-1.08
  gi|189054178 unnamed protein product 66.0/7.62 3 5.00 K.SLNNQFASFIDK.V
R.SLDLDSIIAEVK.A
K.LALDLEIATYR.T
 
23 B2MG_HUMAN Beta-2 microglobulin 12.7/5.77 2 18.00 R.VNHVTLSQPK.I
K.VEHSDLSFSK.D
1.35
24 NDUBA_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 20.8/8.60 3 20.35 (K)AFDLIVDRPVTLVR(E)
(K)EVEQFTQVAK(A)
(R)YQDLGAYSSAR(K)
-1.05
  gi|189054178 unnamed protein product 65.9/7.62 7 12.00 R.TNAENEFVTIK.K
R.SLDLDSIIAEVK.A
K.YEELQITAGR.H
K.LNDLEDALQQAK.E
K.LALDLEIATYR.T
R.TLLEGEESR.M
R.GSGGGSSGGSIGGR.G
 
25 ASCC1_HUMAN Activating signal cointegrator 1 complex subunit 1 45.48/5.22 1 1.75 (R)SFALLPR(L) 1.11
  PHB_HUMAN prohibitin 29.8/5.57 11 52.00 K.FGLALAVAGGVVNSALYNVDAGHR.A
K.DLQNVNITLR.I
R.FDAGELITQR.E
R.AATFGLILDDVSLTHLTFGK.E
K.EFTEAVEAK.Q
K.QVAQQEAER.A
K.AAIISAEGDSK.A
K.AAELIANSLATAGDGLIELR.K
R.KLEAAEDIAYQLSR.S
K.LEAAEDIAYQLSR.S
R.NITYLPAGQSVLLQLPQ.-
 
26 PHB_HUMAN Prohibitin 29.8/5.57 13 59.00 K.VFESIGK.F
K.DLQNVNITLR.I
R.ILFRPVASQLPR.I
R.IFTSIGEDYDER.V
R.VLPSITTEILK.S
R.FDAGELITQR.E
R.AATFGLILDDVSLTHLTFGK.E
K.EFTEAVEAK.Q
K.QVAQQEAER.A
K.AAIISAEGDSK.A
K.AAELIANSLATAGDGLIELR.K
R.KLEAAEDIAYQLSR.S
R.NITYLPAGQSVLLQLPQ.-
1.06
  NDUS3_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial 30.2/6.99 2 9.00 K.SLVDLTAVDVPTR.Q
K.DFPLSGYVELR.Y
 
  1. Note: Spot no. 1, 3, 5, 7, 13 and 14 were matched from our hepatocellular carcinoma cell line database. *The density of spots were calculated as percent volume and shown in this table as folds of increase or decrease (-).